Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,911
  2. Avatar for Go Science 2. Go Science 76 pts. 9,893
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,874
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,866
  5. Avatar for Contenders 5. Contenders 29 pts. 9,779
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,763
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,736
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 9,712
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,675
  10. Avatar for Russian team 10. Russian team 4 pts. 9,663
  1. Avatar for pvc78 41. pvc78 Lv 1 26 pts. 9,508
  2. Avatar for nicobul 42. nicobul Lv 1 25 pts. 9,464
  3. Avatar for Norrjane 43. Norrjane Lv 1 24 pts. 9,460
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 23 pts. 9,453
  5. Avatar for heather-1 45. heather-1 Lv 1 22 pts. 9,448
  6. Avatar for diamonddays 46. diamonddays Lv 1 21 pts. 9,446
  7. Avatar for Mark- 47. Mark- Lv 1 20 pts. 9,446
  8. Avatar for Vinara 48. Vinara Lv 1 20 pts. 9,440
  9. Avatar for toshiue 49. toshiue Lv 1 19 pts. 9,435
  10. Avatar for guineapig 50. guineapig Lv 1 18 pts. 9,429

Comments