Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,343
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,114
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 8,487
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,464
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,424
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,719
  7. Avatar for freefolder 17. freefolder 1 pt. 7,447
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,938
  9. Avatar for Deleted group 19. Deleted group pts. 6,805
  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 17 pts. 9,410
  2. Avatar for jobo0502 52. jobo0502 Lv 1 17 pts. 9,407
  3. Avatar for dbuske 53. dbuske Lv 1 16 pts. 9,370
  4. Avatar for Idiotboy 54. Idiotboy Lv 1 15 pts. 9,369
  5. Avatar for Wojcimierz 55. Wojcimierz Lv 1 15 pts. 9,363
  6. Avatar for gdnskye 56. gdnskye Lv 1 14 pts. 9,343
  7. Avatar for Aminal88 57. Aminal88 Lv 1 13 pts. 9,343
  8. Avatar for Jesse Pinkman 58. Jesse Pinkman Lv 1 13 pts. 9,284
  9. Avatar for Glen B 59. Glen B Lv 1 12 pts. 9,249
  10. Avatar for jausmh 60. jausmh Lv 1 12 pts. 9,246

Comments