Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,911
  2. Avatar for Go Science 2. Go Science 76 pts. 9,893
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,874
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,866
  5. Avatar for Contenders 5. Contenders 29 pts. 9,779
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,763
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,736
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 9,712
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,675
  10. Avatar for Russian team 10. Russian team 4 pts. 9,663
  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 17 pts. 9,410
  2. Avatar for jobo0502 52. jobo0502 Lv 1 17 pts. 9,407
  3. Avatar for dbuske 53. dbuske Lv 1 16 pts. 9,370
  4. Avatar for Idiotboy 54. Idiotboy Lv 1 15 pts. 9,369
  5. Avatar for Wojcimierz 55. Wojcimierz Lv 1 15 pts. 9,363
  6. Avatar for gdnskye 56. gdnskye Lv 1 14 pts. 9,343
  7. Avatar for Aminal88 57. Aminal88 Lv 1 13 pts. 9,343
  8. Avatar for Jesse Pinkman 58. Jesse Pinkman Lv 1 13 pts. 9,284
  9. Avatar for Glen B 59. Glen B Lv 1 12 pts. 9,249
  10. Avatar for jausmh 60. jausmh Lv 1 12 pts. 9,246

Comments