Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for borattt 141. borattt Lv 1 1 pt. 5,907
  2. Avatar for CB19Chro 142. CB19Chro Lv 1 1 pt. 5,857
  3. Avatar for CB19ALEX 143. CB19ALEX Lv 1 1 pt. 5,725
  4. Avatar for CB19WIER 144. CB19WIER Lv 1 1 pt. 5,725
  5. Avatar for CB19GUNN 145. CB19GUNN Lv 1 1 pt. 5,571
  6. Avatar for CB19Peck 146. CB19Peck Lv 1 1 pt. 5,515
  7. Avatar for CB19REAM 147. CB19REAM Lv 1 1 pt. 5,368
  8. Avatar for boiled 148. boiled Lv 1 1 pt. 5,264
  9. Avatar for jakubhalamek 149. jakubhalamek Lv 1 1 pt. 5,185
  10. Avatar for babaksit 150. babaksit Lv 1 1 pt. 4,944

Comments