Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377

  1. Avatar for CB19Rolf 151. CB19Rolf Lv 1 1 pt. 4,781
  2. Avatar for CB19BLAC 152. CB19BLAC Lv 1 1 pt. 3,668
  3. Avatar for 01010011111 153. 01010011111 Lv 1 1 pt. 3,106
  4. Avatar for Hollinas 155. Hollinas Lv 1 1 pt. 0
  5. Avatar for Grom 156. Grom Lv 1 1 pt. 0
  6. Avatar for lamoille 157. lamoille Lv 1 1 pt. 0
  7. Avatar for hpaege 158. hpaege Lv 1 1 pt. 0

Comments