Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for tarimo 41. tarimo Lv 1 24 pts. 10,815
  2. Avatar for spvincent 42. spvincent Lv 1 24 pts. 10,801
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 23 pts. 10,797
  4. Avatar for jamiexq 44. jamiexq Lv 1 22 pts. 10,776
  5. Avatar for alcor29 45. alcor29 Lv 1 21 pts. 10,755
  6. Avatar for Phyx 46. Phyx Lv 1 20 pts. 10,741
  7. Avatar for Hellcat6 47. Hellcat6 Lv 1 19 pts. 10,738
  8. Avatar for georg137 48. georg137 Lv 1 18 pts. 10,707
  9. Avatar for MicElephant 49. MicElephant Lv 1 18 pts. 10,617
  10. Avatar for DoctorSockrates 50. DoctorSockrates Lv 1 17 pts. 10,610

Comments