Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,483
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 10,126
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,551
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,352
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,339
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,286
  7. Avatar for Deleted group 17. Deleted group pts. 7,377
  1. Avatar for orily1337 61. orily1337 Lv 1 10 pts. 10,438
  2. Avatar for xavierhochart 62. xavierhochart Lv 1 10 pts. 10,402
  3. Avatar for pi r squared 63. pi r squared Lv 1 9 pts. 10,399
  4. Avatar for stomjoh 64. stomjoh Lv 1 9 pts. 10,346
  5. Avatar for TastyMunchies 65. TastyMunchies Lv 1 8 pts. 10,332
  6. Avatar for MrZanav 66. MrZanav Lv 1 8 pts. 10,328
  7. Avatar for Deleted player 67. Deleted player 8 pts. 10,296
  8. Avatar for Flagg65a 68. Flagg65a Lv 1 7 pts. 10,286
  9. Avatar for benrh 69. benrh Lv 1 7 pts. 10,265
  10. Avatar for Anfinsen_slept_here 70. Anfinsen_slept_here Lv 1 7 pts. 10,250

Comments