Placeholder image of a protein
Icon representing a puzzle

1624: Revisiting Puzzle 94: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,500
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 9,213
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,125
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,105
  5. Avatar for freefolder 15. freefolder 1 pt. 8,423
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 8,138
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 8,068
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,397
  1. Avatar for benrh 81. benrh Lv 1 3 pts. 9,218
  2. Avatar for oureion 82. oureion Lv 1 3 pts. 9,213
  3. Avatar for Grom 83. Grom Lv 1 3 pts. 9,208
  4. Avatar for ViJay7019 84. ViJay7019 Lv 1 3 pts. 9,184
  5. Avatar for pfirth 85. pfirth Lv 1 3 pts. 9,182
  6. Avatar for orily1337 86. orily1337 Lv 1 2 pts. 9,173
  7. Avatar for cbwest 87. cbwest Lv 1 2 pts. 9,152
  8. Avatar for Jesse Pinkman 88. Jesse Pinkman Lv 1 2 pts. 9,134
  9. Avatar for Pibeagles1 89. Pibeagles1 Lv 1 2 pts. 9,127
  10. Avatar for JasperD 90. JasperD Lv 1 2 pts. 9,125

Comments

Bletchley Park Lv 1

Thank you for sharing Loci, but what is the point of revisiting these puzzles if the structure is known, previous solutions are shown and a script is given that you can load, enter a parameter in and start ?
I thought the purpose was to see if players can solve the structure all by themselves without prior knowledge ?

tyler0911 Lv 1

My understanding is that these Revisiting puzzles are primarily intended to gauge how much Foldit's new tools have improved players' ability to generate more accurate solutions. Bridge Wiggle is definitely a useful tool, but it's not always the best way to assemble bridges IMO and I don't think it takes away from the goal of puzzles like 1624. In this case, I did not use Bridge Wiggle for my current high score on 1624 because doing so caused the cysteine residues to score poorly in my other attempts

frood66 Lv 1

I take on board both the comments above.

Then I have a nasty word for some - laziness.

I fear this is the way foldit has been going for a long time.

Sorry if that sounds harsh.