Placeholder image of a protein
Icon representing a puzzle

1624: Revisiting Puzzle 94: Mouse

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,616
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,460
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,392
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,308
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,307
  6. Avatar for Go Science 6. Go Science 18 pts. 10,280
  7. Avatar for Contenders 7. Contenders 12 pts. 10,270
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,241
  9. Avatar for Russian team 9. Russian team 5 pts. 10,121
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,925

  1. Avatar for Ciccillo 141. Ciccillo Lv 1 1 pt. 8,138
  2. Avatar for hdouglas8282 142. hdouglas8282 Lv 1 1 pt. 8,133
  3. Avatar for zdong 143. zdong Lv 1 1 pt. 8,108
  4. Avatar for katling 144. katling Lv 1 1 pt. 8,072
  5. Avatar for BIOC402_Flo_Rob 145. BIOC402_Flo_Rob Lv 1 1 pt. 8,068
  6. Avatar for Ardbegger 146. Ardbegger Lv 1 1 pt. 8,061
  7. Avatar for franzemanz 147. franzemanz Lv 1 1 pt. 7,957
  8. Avatar for lamoille 148. lamoille Lv 1 1 pt. 7,826
  9. Avatar for doctaven 149. doctaven Lv 1 1 pt. 7,397
  10. Avatar for 01010011111 150. 01010011111 Lv 1 1 pt. 6,857

Comments


Bletchley Park Lv 1

Thank you for sharing Loci, but what is the point of revisiting these puzzles if the structure is known, previous solutions are shown and a script is given that you can load, enter a parameter in and start ?
I thought the purpose was to see if players can solve the structure all by themselves without prior knowledge ?

tyler0911 Lv 1

My understanding is that these Revisiting puzzles are primarily intended to gauge how much Foldit's new tools have improved players' ability to generate more accurate solutions. Bridge Wiggle is definitely a useful tool, but it's not always the best way to assemble bridges IMO and I don't think it takes away from the goal of puzzles like 1624. In this case, I did not use Bridge Wiggle for my current high score on 1624 because doing so caused the cysteine residues to score poorly in my other attempts

frood66 Lv 1

I take on board both the comments above.

Then I have a nasty word for some - laziness.

I fear this is the way foldit has been going for a long time.

Sorry if that sounds harsh.