Placeholder image of a protein
Icon representing a puzzle

1624: Revisiting Puzzle 94: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,616
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,460
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,392
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,308
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,307
  6. Avatar for Go Science 6. Go Science 18 pts. 10,280
  7. Avatar for Contenders 7. Contenders 12 pts. 10,270
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,241
  9. Avatar for Russian team 9. Russian team 5 pts. 10,121
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,925

  1. Avatar for hpaege 151. hpaege Lv 1 1 pt. 6,563
  2. Avatar for rmoretti 152. rmoretti Lv 1 1 pt. 3,823
  3. Avatar for ManVsYard 153. ManVsYard Lv 1 1 pt. 3,821
  4. Avatar for protein.plus 154. protein.plus Lv 1 1 pt. 3,821
  5. Avatar for xiyuzj 155. xiyuzj Lv 1 1 pt. 3,821
  6. Avatar for Hollinas 156. Hollinas Lv 1 1 pt. 3,821
  7. Avatar for isa.qui.cs234 157. isa.qui.cs234 Lv 1 1 pt. 3,821

Comments


Bletchley Park Lv 1

Thank you for sharing Loci, but what is the point of revisiting these puzzles if the structure is known, previous solutions are shown and a script is given that you can load, enter a parameter in and start ?
I thought the purpose was to see if players can solve the structure all by themselves without prior knowledge ?

tyler0911 Lv 1

My understanding is that these Revisiting puzzles are primarily intended to gauge how much Foldit's new tools have improved players' ability to generate more accurate solutions. Bridge Wiggle is definitely a useful tool, but it's not always the best way to assemble bridges IMO and I don't think it takes away from the goal of puzzles like 1624. In this case, I did not use Bridge Wiggle for my current high score on 1624 because doing so caused the cysteine residues to score poorly in my other attempts

frood66 Lv 1

I take on board both the comments above.

Then I have a nasty word for some - laziness.

I fear this is the way foldit has been going for a long time.

Sorry if that sounds harsh.