Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734

  1. Avatar for kludbrook 91. kludbrook Lv 1 2 pts. 9,844
  2. Avatar for sydlg19 92. sydlg19 Lv 1 2 pts. 9,838
  3. Avatar for erexer 93. erexer Lv 1 2 pts. 9,832
  4. Avatar for cobaltteal 94. cobaltteal Lv 1 2 pts. 9,819
  5. Avatar for sjgifford 95. sjgifford Lv 1 2 pts. 9,815
  6. Avatar for fisherlr777 96. fisherlr777 Lv 1 2 pts. 9,810
  7. Avatar for reefyrob 97. reefyrob Lv 1 1 pt. 9,792
  8. Avatar for ehhan2018 98. ehhan2018 Lv 1 1 pt. 9,764
  9. Avatar for Znaika 99. Znaika Lv 1 1 pt. 9,764
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 9,756

Comments