Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734
  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 51 pts. 10,603
  2. Avatar for Aminal88 22. Aminal88 Lv 1 50 pts. 10,595
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 48 pts. 10,589
  4. Avatar for jobo0502 24. jobo0502 Lv 1 46 pts. 10,581
  5. Avatar for retiredmichael 25. retiredmichael Lv 1 44 pts. 10,580
  6. Avatar for Sissue 26. Sissue Lv 1 43 pts. 10,577
  7. Avatar for TastyMunchies 27. TastyMunchies Lv 1 41 pts. 10,565
  8. Avatar for Blipperman 28. Blipperman Lv 1 40 pts. 10,565
  9. Avatar for cbwest 29. cbwest Lv 1 38 pts. 10,563
  10. Avatar for johnmitch 30. johnmitch Lv 1 37 pts. 10,554

Comments