Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734
  1. Avatar for diamonddays 31. diamonddays Lv 1 35 pts. 10,547
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 34 pts. 10,546
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 33 pts. 10,546
  4. Avatar for DoctorSockrates 34. DoctorSockrates Lv 1 31 pts. 10,542
  5. Avatar for vakobo 35. vakobo Lv 1 30 pts. 10,538
  6. Avatar for dcrwheeler 36. dcrwheeler Lv 1 29 pts. 10,533
  7. Avatar for orily1337 37. orily1337 Lv 1 28 pts. 10,530
  8. Avatar for manu8170 38. manu8170 Lv 1 27 pts. 10,522
  9. Avatar for O Seki To 39. O Seki To Lv 1 26 pts. 10,513
  10. Avatar for pvc78 40. pvc78 Lv 1 25 pts. 10,512

Comments