Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734

  1. Avatar for georg137 41. georg137 Lv 1 24 pts. 10,505
  2. Avatar for Merf 42. Merf Lv 1 23 pts. 10,501
  3. Avatar for Mark- 43. Mark- Lv 1 22 pts. 10,481
  4. Avatar for frood66 44. frood66 Lv 1 21 pts. 10,479
  5. Avatar for alwen 45. alwen Lv 1 20 pts. 10,420
  6. Avatar for Vinara 46. Vinara Lv 1 19 pts. 10,376
  7. Avatar for YeshuaLives 47. YeshuaLives Lv 1 18 pts. 10,368
  8. Avatar for Norrjane 48. Norrjane Lv 1 18 pts. 10,365
  9. Avatar for silent gene 49. silent gene Lv 1 17 pts. 10,349
  10. Avatar for Hellcat6 50. Hellcat6 Lv 1 16 pts. 10,335

Comments