Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734
  1. Avatar for Glen B 51. Glen B Lv 1 15 pts. 10,328
  2. Avatar for guineapig 52. guineapig Lv 1 15 pts. 10,310
  3. Avatar for MicElephant 53. MicElephant Lv 1 14 pts. 10,308
  4. Avatar for carsonfb 54. carsonfb Lv 1 13 pts. 10,306
  5. Avatar for @lison 55. @lison Lv 1 13 pts. 10,298
  6. Avatar for aznarog 56. aznarog Lv 1 12 pts. 10,284
  7. Avatar for phi16 57. phi16 Lv 1 12 pts. 10,281
  8. Avatar for heather-1 58. heather-1 Lv 1 11 pts. 10,276
  9. Avatar for pfirth 59. pfirth Lv 1 11 pts. 10,273
  10. Avatar for jamiexq 60. jamiexq Lv 1 10 pts. 10,264

Comments