Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 10,350
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 97 pts. 10,249
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,240
  4. Avatar for actiasluna 4. actiasluna Lv 1 89 pts. 10,225
  5. Avatar for LociOiling 5. LociOiling Lv 1 86 pts. 10,221
  6. Avatar for grogar7 6. grogar7 Lv 1 83 pts. 10,212
  7. Avatar for Steven Pletsch 7. Steven Pletsch Lv 1 79 pts. 10,206
  8. Avatar for frood66 8. frood66 Lv 1 76 pts. 10,170
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 73 pts. 10,169
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 70 pts. 10,164

Comments