Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 10,350
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 97 pts. 10,249
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,240
  4. Avatar for actiasluna 4. actiasluna Lv 1 89 pts. 10,225
  5. Avatar for LociOiling 5. LociOiling Lv 1 86 pts. 10,221
  6. Avatar for grogar7 6. grogar7 Lv 1 83 pts. 10,212
  7. Avatar for Steven Pletsch 7. Steven Pletsch Lv 1 79 pts. 10,206
  8. Avatar for frood66 8. frood66 Lv 1 76 pts. 10,170
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 73 pts. 10,169
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 70 pts. 10,164

Comments