Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups


  1. Avatar for Beta Folders 100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,357
  2. Avatar for smilingone 2. smilingone Lv 1 83 pts. 10,355
  3. Avatar for Deleted player 3. Deleted player 69 pts. 10,346
  4. Avatar for reefyrob 4. reefyrob Lv 1 56 pts. 10,246
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 45 pts. 10,241
  6. Avatar for Phyx 6. Phyx Lv 1 36 pts. 10,228
  7. Avatar for actiasluna 7. actiasluna Lv 1 29 pts. 10,227
  8. Avatar for Galaxie 8. Galaxie Lv 1 23 pts. 10,226
  9. Avatar for tyler0911 9. tyler0911 Lv 1 18 pts. 10,220
  10. Avatar for Blipperman 10. Blipperman Lv 1 14 pts. 10,220

Comments