Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for Hollinas 11. Hollinas Lv 1 10 pts. 10,219
  2. Avatar for Anfinsen_slept_here 12. Anfinsen_slept_here Lv 1 8 pts. 10,215
  3. Avatar for fisherlr777 13. fisherlr777 Lv 1 6 pts. 10,215
  4. Avatar for robgee 14. robgee Lv 1 4 pts. 10,213
  5. Avatar for Sissue 15. Sissue Lv 1 3 pts. 10,208
  6. Avatar for silent gene 16. silent gene Lv 1 2 pts. 10,206
  7. Avatar for lamoille 17. lamoille Lv 1 2 pts. 10,204
  8. Avatar for gdnskye 18. gdnskye Lv 1 1 pt. 10,190
  9. Avatar for alcor29 19. alcor29 Lv 1 1 pt. 10,190
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 10,176

Comments