Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups


  1. Avatar for Beta Folders 100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097

  1. Avatar for spvincent 41. spvincent Lv 1 16 pts. 9,896
  2. Avatar for O Seki To 42. O Seki To Lv 1 15 pts. 9,895
  3. Avatar for isaksson 43. isaksson Lv 1 14 pts. 9,891
  4. Avatar for tarimo 44. tarimo Lv 1 14 pts. 9,881
  5. Avatar for johnmitch 45. johnmitch Lv 1 13 pts. 9,874
  6. Avatar for smilingone 46. smilingone Lv 1 12 pts. 9,844
  7. Avatar for jamiexq 47. jamiexq Lv 1 12 pts. 9,837
  8. Avatar for Blipperman 48. Blipperman Lv 1 11 pts. 9,824
  9. Avatar for mitarcher 49. mitarcher Lv 1 10 pts. 9,821
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 10 pts. 9,803

Comments