Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for dbuske 101. dbuske Lv 1 1 pt. 8,769
  2. Avatar for sjgifford 102. sjgifford Lv 1 1 pt. 8,758
  3. Avatar for fisherlr777 103. fisherlr777 Lv 1 1 pt. 8,751
  4. Avatar for Flagg65a 104. Flagg65a Lv 1 1 pt. 8,724
  5. Avatar for ourtown 105. ourtown Lv 1 1 pt. 8,714
  6. Avatar for zid 106. zid Lv 1 1 pt. 8,679
  7. Avatar for GUANINJIN 107. GUANINJIN Lv 1 1 pt. 8,676
  8. Avatar for ehhan2018 108. ehhan2018 Lv 1 1 pt. 8,676
  9. Avatar for henur 109. henur Lv 1 1 pt. 8,670
  10. Avatar for lionium 110. lionium Lv 1 1 pt. 8,664

Comments