Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811

  1. Avatar for dbuske 101. dbuske Lv 1 1 pt. 8,769
  2. Avatar for sjgifford 102. sjgifford Lv 1 1 pt. 8,758
  3. Avatar for fisherlr777 103. fisherlr777 Lv 1 1 pt. 8,751
  4. Avatar for Flagg65a 104. Flagg65a Lv 1 1 pt. 8,724
  5. Avatar for ourtown 105. ourtown Lv 1 1 pt. 8,714
  6. Avatar for zid 106. zid Lv 1 1 pt. 8,679
  7. Avatar for GUANINJIN 107. GUANINJIN Lv 1 1 pt. 8,676
  8. Avatar for ehhan2018 108. ehhan2018 Lv 1 1 pt. 8,676
  9. Avatar for henur 109. henur Lv 1 1 pt. 8,670
  10. Avatar for lionium 110. lionium Lv 1 1 pt. 8,664

Comments