Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  9. Avatar for BIOF215 20. BIOF215 1 pt. 8,082

  1. Avatar for cobaltteal 111. cobaltteal Lv 1 1 pt. 8,646
  2. Avatar for lconor 112. lconor Lv 1 1 pt. 8,638
  3. Avatar for andrewxc 113. andrewxc Lv 1 1 pt. 8,635
  4. Avatar for nong9090 114. nong9090 Lv 1 1 pt. 8,622
  5. Avatar for drumpeter18yrs9yrs 115. drumpeter18yrs9yrs Lv 1 1 pt. 8,611
  6. Avatar for alwan2018 116. alwan2018 Lv 1 1 pt. 8,580
  7. Avatar for murdock88 117. murdock88 Lv 1 1 pt. 8,579
  8. Avatar for yavij2019 119. yavij2019 Lv 1 1 pt. 8,565
  9. Avatar for RootBeerSwordsman 120. RootBeerSwordsman Lv 1 1 pt. 8,560

Comments