Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811

  1. Avatar for cobaltteal 111. cobaltteal Lv 1 1 pt. 8,646
  2. Avatar for lconor 112. lconor Lv 1 1 pt. 8,638
  3. Avatar for andrewxc 113. andrewxc Lv 1 1 pt. 8,635
  4. Avatar for nong9090 114. nong9090 Lv 1 1 pt. 8,622
  5. Avatar for drumpeter18yrs9yrs 115. drumpeter18yrs9yrs Lv 1 1 pt. 8,611
  6. Avatar for alwan2018 116. alwan2018 Lv 1 1 pt. 8,580
  7. Avatar for murdock88 117. murdock88 Lv 1 1 pt. 8,579
  8. Avatar for yavij2019 119. yavij2019 Lv 1 1 pt. 8,565
  9. Avatar for RootBeerSwordsman 120. RootBeerSwordsman Lv 1 1 pt. 8,560

Comments