Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 9,572
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,101
  3. Avatar for DW 2020 13. DW 2020 2 pts. 8,987
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,958
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,847
  6. Avatar for freefolder 16. freefolder 1 pt. 8,819
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,521
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,313
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,160
  10. Avatar for BIOF215 20. BIOF215 1 pt. 8,082
  1. Avatar for robgee 21. robgee Lv 1 53 pts. 9,895
  2. Avatar for Blipperman 22. Blipperman Lv 1 51 pts. 9,891
  3. Avatar for guineapig 23. guineapig Lv 1 50 pts. 9,883
  4. Avatar for Deleted player 24. Deleted player 48 pts. 9,883
  5. Avatar for Museka 25. Museka Lv 1 46 pts. 9,874
  6. Avatar for pvc78 26. pvc78 Lv 1 45 pts. 9,855
  7. Avatar for DoctorSockrates 27. DoctorSockrates Lv 1 43 pts. 9,849
  8. Avatar for stomjoh 28. stomjoh Lv 1 42 pts. 9,847
  9. Avatar for smilingone 29. smilingone Lv 1 40 pts. 9,847
  10. Avatar for Maerlyn138 30. Maerlyn138 Lv 1 39 pts. 9,837

Comments