Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811
  1. Avatar for robgee 21. robgee Lv 1 53 pts. 9,895
  2. Avatar for Blipperman 22. Blipperman Lv 1 51 pts. 9,891
  3. Avatar for guineapig 23. guineapig Lv 1 50 pts. 9,883
  4. Avatar for Deleted player 24. Deleted player 48 pts. 9,883
  5. Avatar for Museka 25. Museka Lv 1 46 pts. 9,874
  6. Avatar for pvc78 26. pvc78 Lv 1 45 pts. 9,855
  7. Avatar for DoctorSockrates 27. DoctorSockrates Lv 1 43 pts. 9,849
  8. Avatar for stomjoh 28. stomjoh Lv 1 42 pts. 9,847
  9. Avatar for smilingone 29. smilingone Lv 1 40 pts. 9,847
  10. Avatar for Maerlyn138 30. Maerlyn138 Lv 1 39 pts. 9,837

Comments