Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129

  1. Avatar for Auntecedent 121. Auntecedent Lv 1 1 pt. 8,552
  2. Avatar for mikim2018 122. mikim2018 Lv 1 1 pt. 8,534
  3. Avatar for oureion 123. oureion Lv 1 1 pt. 8,521
  4. Avatar for ViJay7019 124. ViJay7019 Lv 1 1 pt. 8,494
  5. Avatar for lamoille 125. lamoille Lv 1 1 pt. 8,493
  6. Avatar for Simek 126. Simek Lv 1 1 pt. 8,485
  7. Avatar for utils 127. utils Lv 1 1 pt. 8,471
  8. Avatar for srrao2019 128. srrao2019 Lv 1 1 pt. 8,470
  9. Avatar for Knoblerine 129. Knoblerine Lv 1 1 pt. 8,463
  10. Avatar for Kurtis Anderson 130. Kurtis Anderson Lv 1 1 pt. 8,457

Comments