Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129
  1. Avatar for mhefford1 131. mhefford1 Lv 1 1 pt. 8,449
  2. Avatar for multaq 132. multaq Lv 1 1 pt. 8,445
  3. Avatar for momadoc 133. momadoc Lv 1 1 pt. 8,434
  4. Avatar for learp 134. learp Lv 1 1 pt. 8,432
  5. Avatar for hajtogato 135. hajtogato Lv 1 1 pt. 8,419
  6. Avatar for caseymcdonald 136. caseymcdonald Lv 1 1 pt. 8,410
  7. Avatar for blee2 137. blee2 Lv 1 1 pt. 8,400
  8. Avatar for lange 138. lange Lv 1 1 pt. 8,360
  9. Avatar for okolan 139. okolan Lv 1 1 pt. 8,357
  10. Avatar for anli2019 140. anli2019 Lv 1 1 pt. 8,322

Comments