Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129

  1. Avatar for katling 141. katling Lv 1 1 pt. 8,316
  2. Avatar for nathanmills 142. nathanmills Lv 1 1 pt. 8,313
  3. Avatar for Sydefecks 143. Sydefecks Lv 1 1 pt. 8,268
  4. Avatar for jhat 144. jhat Lv 1 1 pt. 8,257
  5. Avatar for smais 145. smais Lv 1 1 pt. 8,247
  6. Avatar for legotankman 146. legotankman Lv 1 1 pt. 8,241
  7. Avatar for Snipemebud 147. Snipemebud Lv 1 1 pt. 8,183
  8. Avatar for maur9357 148. maur9357 Lv 1 1 pt. 8,183
  9. Avatar for SonofNolan 149. SonofNolan Lv 1 1 pt. 8,161
  10. Avatar for doctaven 150. doctaven Lv 1 1 pt. 8,160

Comments