Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129
  1. Avatar for C o n s u m e 151. C o n s u m e Lv 1 1 pt. 8,157
  2. Avatar for Agent19 152. Agent19 Lv 1 1 pt. 8,156
  3. Avatar for thel0lminecrafter 153. thel0lminecrafter Lv 1 1 pt. 8,155
  4. Avatar for PlagueRat 154. PlagueRat Lv 1 1 pt. 8,112
  5. Avatar for peanutbutterwithhoney 155. peanutbutterwithhoney Lv 1 1 pt. 8,097
  6. Avatar for timusinv 156. timusinv Lv 1 1 pt. 8,082
  7. Avatar for Steven Pletsch 157. Steven Pletsch Lv 1 1 pt. 8,072
  8. Avatar for wisky 158. wisky Lv 1 1 pt. 8,062
  9. Avatar for Willyanto 159. Willyanto Lv 1 1 pt. 8,057
  10. Avatar for ti_go_Mars 160. ti_go_Mars Lv 1 1 pt. 8,027

Comments