Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129

  1. Avatar for Skippysk8s 41. Skippysk8s Lv 1 26 pts. 9,789
  2. Avatar for Vinara 42. Vinara Lv 1 25 pts. 9,763
  3. Avatar for jamiexq 43. jamiexq Lv 1 24 pts. 9,760
  4. Avatar for nicobul 44. nicobul Lv 1 23 pts. 9,754
  5. Avatar for isaksson 45. isaksson Lv 1 22 pts. 9,727
  6. Avatar for tarimo 46. tarimo Lv 1 21 pts. 9,726
  7. Avatar for alcor29 47. alcor29 Lv 1 20 pts. 9,709
  8. Avatar for diamonddays 48. diamonddays Lv 1 19 pts. 9,668
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 19 pts. 9,665
  10. Avatar for MicElephant 50. MicElephant Lv 1 18 pts. 9,660

Comments