Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129
  1. Avatar for cbwest 61. cbwest Lv 1 11 pts. 9,369
  2. Avatar for crpainter 62. crpainter Lv 1 11 pts. 9,336
  3. Avatar for georg137 63. georg137 Lv 1 10 pts. 9,316
  4. Avatar for @lison 64. @lison Lv 1 10 pts. 9,267
  5. Avatar for Merf 65. Merf Lv 1 9 pts. 9,249
  6. Avatar for Anfinsen_slept_here 66. Anfinsen_slept_here Lv 1 9 pts. 9,223
  7. Avatar for lensman3 67. lensman3 Lv 1 8 pts. 9,207
  8. Avatar for Artoria2e5 68. Artoria2e5 Lv 1 8 pts. 9,204
  9. Avatar for heather-1 69. heather-1 Lv 1 8 pts. 9,182
  10. Avatar for WBarme1234 70. WBarme1234 Lv 1 7 pts. 9,178

Comments