Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129
  1. Avatar for rezaefar 71. rezaefar Lv 1 7 pts. 9,158
  2. Avatar for pandapharmd 72. pandapharmd Lv 1 7 pts. 9,145
  3. Avatar for jausmh 73. jausmh Lv 1 6 pts. 9,112
  4. Avatar for Arne Heessels 74. Arne Heessels Lv 1 6 pts. 9,103
  5. Avatar for JasperD 75. JasperD Lv 1 6 pts. 9,101
  6. Avatar for NR22 76. NR22 Lv 1 5 pts. 9,100
  7. Avatar for pfirth 77. pfirth Lv 1 5 pts. 9,071
  8. Avatar for borattt 78. borattt Lv 1 5 pts. 9,063
  9. Avatar for Alistair69 79. Alistair69 Lv 1 5 pts. 9,031
  10. Avatar for benrh 80. benrh Lv 1 4 pts. 9,025

Comments