Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811

  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 37 pts. 9,832
  2. Avatar for O Seki To 32. O Seki To Lv 1 36 pts. 9,831
  3. Avatar for fpc 33. fpc Lv 1 35 pts. 9,831
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 34 pts. 9,827
  5. Avatar for vakobo 35. vakobo Lv 1 32 pts. 9,811
  6. Avatar for Marvelz 36. Marvelz Lv 1 31 pts. 9,808
  7. Avatar for Glen B 37. Glen B Lv 1 30 pts. 9,806
  8. Avatar for aznarog 38. aznarog Lv 1 29 pts. 9,793
  9. Avatar for YeshuaLives 39. YeshuaLives Lv 1 28 pts. 9,791
  10. Avatar for Crossed Sticks 40. Crossed Sticks Lv 1 27 pts. 9,790

Comments