Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for Steven Pletsch
    1. Steven Pletsch Lv 1
    100 pts. 10,538
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,510
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 95 pts. 10,457
  4. Avatar for robgee 4. robgee Lv 1 92 pts. 10,448
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 89 pts. 10,427
  6. Avatar for tyler0911 6. tyler0911 Lv 1 86 pts. 10,415
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 83 pts. 10,407
  8. Avatar for Galaxie 8. Galaxie Lv 1 81 pts. 10,402
  9. Avatar for smilingone 9. smilingone Lv 1 78 pts. 10,400
  10. Avatar for grogar7 10. grogar7 Lv 1 76 pts. 10,388

Comments