Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202

  1. Avatar for Steven Pletsch
    1. Steven Pletsch Lv 1
    100 pts. 10,538
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,510
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 95 pts. 10,457
  4. Avatar for robgee 4. robgee Lv 1 92 pts. 10,448
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 89 pts. 10,427
  6. Avatar for tyler0911 6. tyler0911 Lv 1 86 pts. 10,415
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 83 pts. 10,407
  8. Avatar for Galaxie 8. Galaxie Lv 1 81 pts. 10,402
  9. Avatar for smilingone 9. smilingone Lv 1 78 pts. 10,400
  10. Avatar for grogar7 10. grogar7 Lv 1 76 pts. 10,388

Comments