Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,617
  2. Avatar for phi16 2. phi16 Lv 1 84 pts. 10,569
  3. Avatar for robgee 3. robgee Lv 1 70 pts. 10,563
  4. Avatar for lamoille 4. lamoille Lv 1 58 pts. 10,561
  5. Avatar for Aminal88 5. Aminal88 Lv 1 48 pts. 10,536
  6. Avatar for Deleted player 6. Deleted player 39 pts. 10,516
  7. Avatar for LociOiling 7. LociOiling Lv 1 32 pts. 10,511
  8. Avatar for smilingone 8. smilingone Lv 1 26 pts. 10,509
  9. Avatar for Steven Pletsch 9. Steven Pletsch Lv 1 20 pts. 10,497
  10. Avatar for jamiexq 10. jamiexq Lv 1 16 pts. 10,475

Comments