Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 13 pts. 10,450
  2. Avatar for reefyrob 12. reefyrob Lv 1 10 pts. 10,438
  3. Avatar for Hollinas 13. Hollinas Lv 1 7 pts. 10,436
  4. Avatar for silent gene 14. silent gene Lv 1 6 pts. 10,428
  5. Avatar for Phyx 15. Phyx Lv 1 4 pts. 10,415
  6. Avatar for mbinfield 16. mbinfield Lv 1 3 pts. 10,408
  7. Avatar for Hellcat6 17. Hellcat6 Lv 1 2 pts. 10,408
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 2 pts. 10,385
  9. Avatar for fisherlr777 19. fisherlr777 Lv 1 1 pt. 10,385
  10. Avatar for Znaika 20. Znaika Lv 1 1 pt. 10,381

Comments