Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for alwen 21. alwen Lv 1 1 pt. 10,376
  2. Avatar for gdnskye 22. gdnskye Lv 1 1 pt. 10,368
  3. Avatar for alcor29 23. alcor29 Lv 1 1 pt. 10,367
  4. Avatar for georg137 24. georg137 Lv 1 1 pt. 10,326
  5. Avatar for tarimo 25. tarimo Lv 1 1 pt. 10,266
  6. Avatar for orily1337 26. orily1337 Lv 1 1 pt. 10,202
  7. Avatar for jausmh 27. jausmh Lv 1 1 pt. 10,192
  8. Avatar for Sissue 28. Sissue Lv 1 1 pt. 10,116
  9. Avatar for dbuske 29. dbuske Lv 1 1 pt. 10,019
  10. Avatar for actiasluna 30. actiasluna Lv 1 1 pt. 9,948

Comments