Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for multaq 151. multaq Lv 1 1 pt. 0
  2. Avatar for Hollinas 152. Hollinas Lv 1 1 pt. 0
  3. Avatar for anku 153. anku Lv 1 1 pt. 0
  4. Avatar for orily1337 154. orily1337 Lv 1 1 pt. 0
  5. Avatar for rahuls 155. rahuls Lv 1 1 pt. 0
  6. Avatar for lionium 156. lionium Lv 1 1 pt. 0
  7. Avatar for mbinfield 157. mbinfield Lv 1 1 pt. 0
  8. Avatar for lamoille 158. lamoille Lv 1 1 pt. 0
  9. Avatar for shashwatmishra776 159. shashwatmishra776 Lv 1 1 pt. 0
  10. Avatar for Idiotboy 160. Idiotboy Lv 1 1 pt. 0

Comments