Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202

  1. Avatar for phi16 21. phi16 Lv 1 53 pts. 10,241
  2. Avatar for Glen B 22. Glen B Lv 1 51 pts. 10,240
  3. Avatar for actiasluna 23. actiasluna Lv 1 49 pts. 10,231
  4. Avatar for Phyx 24. Phyx Lv 1 47 pts. 10,211
  5. Avatar for Museka 25. Museka Lv 1 46 pts. 10,210
  6. Avatar for DoctorSockrates 26. DoctorSockrates Lv 1 44 pts. 10,206
  7. Avatar for frood66 27. frood66 Lv 1 43 pts. 10,194
  8. Avatar for dcrwheeler 28. dcrwheeler Lv 1 41 pts. 10,183
  9. Avatar for guineapig 29. guineapig Lv 1 40 pts. 10,183
  10. Avatar for diamonddays 30. diamonddays Lv 1 38 pts. 10,172

Comments