Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,075
  2. Avatar for Contenders 2. Contenders 78 pts. 11,032
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 11,030
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,940
  6. Avatar for Go Science 6. Go Science 24 pts. 10,891
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,848
  8. Avatar for Gargleblasters 8. Gargleblasters 12 pts. 10,809
  9. Avatar for Russian team 9. Russian team 8 pts. 10,757
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,215
  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 11,070
  2. Avatar for LociOiling 2. LociOiling Lv 1 98 pts. 11,068
  3. Avatar for Mark- 3. Mark- Lv 1 95 pts. 11,032
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 93 pts. 11,030
  5. Avatar for Galaxie 5. Galaxie Lv 1 91 pts. 10,967
  6. Avatar for Museka 6. Museka Lv 1 88 pts. 10,940
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 86 pts. 10,918
  8. Avatar for grogar7 8. grogar7 Lv 1 84 pts. 10,895
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 81 pts. 10,891
  10. Avatar for robgee 10. robgee Lv 1 79 pts. 10,849

Comments