Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 10,063
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  6. Avatar for Deleted group 16. Deleted group pts. 9,609
  7. Avatar for freefolder 17. freefolder 1 pt. 9,580
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  9. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  10. Avatar for BIOF215 20. BIOF215 1 pt. 9,294
  1. Avatar for frostschutz 91. frostschutz Lv 1 5 pts. 9,651
  2. Avatar for NR22 92. NR22 Lv 1 5 pts. 9,640
  3. Avatar for harvardman 93. harvardman Lv 1 4 pts. 9,635
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 4 pts. 9,620
  5. Avatar for Merf 95. Merf Lv 1 4 pts. 9,618
  6. Avatar for poltix 96. poltix Lv 1 4 pts. 9,609
  7. Avatar for lconor 97. lconor Lv 1 4 pts. 9,606
  8. Avatar for Alistair69 98. Alistair69 Lv 1 3 pts. 9,595
  9. Avatar for cobaltteal 99. cobaltteal Lv 1 3 pts. 9,584
  10. Avatar for Altercomp 100. Altercomp Lv 1 3 pts. 9,580

Comments