Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  3. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  4. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  5. Avatar for Deleted group 16. Deleted group pts. 9,609
  6. Avatar for freefolder 17. freefolder 1 pt. 9,580
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  8. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  9. Avatar for BIOF215 20. BIOF215 1 pt. 9,294

  1. Avatar for antibot215 121. antibot215 Lv 1 1 pt. 9,238
  2. Avatar for f20160590 122. f20160590 Lv 1 1 pt. 9,226
  3. Avatar for Steven Pletsch 123. Steven Pletsch Lv 1 1 pt. 9,194
  4. Avatar for multaq 124. multaq Lv 1 1 pt. 9,186
  5. Avatar for maur9357 125. maur9357 Lv 1 1 pt. 9,178
  6. Avatar for learp 126. learp Lv 1 1 pt. 9,176
  7. Avatar for ehhan2018 127. ehhan2018 Lv 1 1 pt. 9,173
  8. Avatar for srrao2019 128. srrao2019 Lv 1 1 pt. 9,168
  9. Avatar for Natuhaka 129. Natuhaka Lv 1 1 pt. 9,156
  10. Avatar for henur 130. henur Lv 1 1 pt. 9,030

Comments