Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  3. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  4. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  5. Avatar for Deleted group 16. Deleted group pts. 9,609
  6. Avatar for freefolder 17. freefolder 1 pt. 9,580
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  8. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  9. Avatar for BIOF215 20. BIOF215 1 pt. 9,294

  1. Avatar for drajan97 161. drajan97 Lv 1 1 pt. 8,660
  2. Avatar for emtonsti 162. emtonsti Lv 1 1 pt. 8,658
  3. Avatar for Nymeria98 164. Nymeria98 Lv 1 1 pt. 8,638
  4. Avatar for rushi 165. rushi Lv 1 1 pt. 8,633
  5. Avatar for Prateek10 166. Prateek10 Lv 1 1 pt. 8,622
  6. Avatar for timusinv 167. timusinv Lv 1 1 pt. 8,617
  7. Avatar for mk1123 168. mk1123 Lv 1 1 pt. 8,609
  8. Avatar for Goku22 169. Goku22 Lv 1 1 pt. 8,593
  9. Avatar for HimSha 170. HimSha Lv 1 1 pt. 8,592

Comments