Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 10,063
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  6. Avatar for Deleted group 16. Deleted group pts. 9,609
  7. Avatar for freefolder 17. freefolder 1 pt. 9,580
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  9. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  10. Avatar for BIOF215 20. BIOF215 1 pt. 9,294
  1. Avatar for emdee314 171. emdee314 Lv 1 1 pt. 8,588
  2. Avatar for shashwatmishra776 172. shashwatmishra776 Lv 1 1 pt. 8,587
  3. Avatar for Piyush768 173. Piyush768 Lv 1 1 pt. 8,584
  4. Avatar for rish5555 174. rish5555 Lv 1 1 pt. 8,583
  5. Avatar for ti_go_Mars 175. ti_go_Mars Lv 1 1 pt. 8,579
  6. Avatar for Philippe_C 176. Philippe_C Lv 1 1 pt. 8,578
  7. Avatar for Snipemebud 177. Snipemebud Lv 1 1 pt. 8,577
  8. Avatar for lamoille 178. lamoille Lv 1 1 pt. 8,550
  9. Avatar for petetrig 179. petetrig Lv 1 1 pt. 8,528
  10. Avatar for amylaseandmie 180. amylaseandmie Lv 1 1 pt. 8,492

Comments