Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 10,063
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  6. Avatar for Deleted group 16. Deleted group pts. 9,609
  7. Avatar for freefolder 17. freefolder 1 pt. 9,580
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  9. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  10. Avatar for BIOF215 20. BIOF215 1 pt. 9,294
  1. Avatar for frood66 11. frood66 Lv 1 77 pts. 10,848
  2. Avatar for Phyx 12. Phyx Lv 1 75 pts. 10,825
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 73 pts. 10,813
  4. Avatar for tyler0911 14. tyler0911 Lv 1 71 pts. 10,813
  5. Avatar for reefyrob 15. reefyrob Lv 1 69 pts. 10,810
  6. Avatar for actiasluna 16. actiasluna Lv 1 67 pts. 10,809
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 65 pts. 10,792
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 63 pts. 10,789
  9. Avatar for TastyMunchies 19. TastyMunchies Lv 1 62 pts. 10,782
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 60 pts. 10,780

Comments