Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  3. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  4. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  5. Avatar for Deleted group 16. Deleted group pts. 9,609
  6. Avatar for freefolder 17. freefolder 1 pt. 9,580
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  8. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  9. Avatar for BIOF215 20. BIOF215 1 pt. 9,294

  1. Avatar for manu8170 21. manu8170 Lv 1 58 pts. 10,773
  2. Avatar for orily1337 22. orily1337 Lv 1 57 pts. 10,771
  3. Avatar for Blipperman 23. Blipperman Lv 1 55 pts. 10,764
  4. Avatar for altejoh 24. altejoh Lv 1 53 pts. 10,762
  5. Avatar for MicElephant 25. MicElephant Lv 1 52 pts. 10,760
  6. Avatar for vakobo 26. vakobo Lv 1 50 pts. 10,757
  7. Avatar for fpc 27. fpc Lv 1 49 pts. 10,745
  8. Avatar for Deleted player 28. Deleted player 47 pts. 10,735
  9. Avatar for guineapig 29. guineapig Lv 1 46 pts. 10,727
  10. Avatar for Sissue 30. Sissue Lv 1 45 pts. 10,721

Comments