Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 10,063
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  6. Avatar for Deleted group 16. Deleted group pts. 9,609
  7. Avatar for freefolder 17. freefolder 1 pt. 9,580
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  9. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  10. Avatar for BIOF215 20. BIOF215 1 pt. 9,294
  1. Avatar for diamonddays 51. diamonddays Lv 1 23 pts. 10,571
  2. Avatar for jausmh 52. jausmh Lv 1 22 pts. 10,559
  3. Avatar for smilingone 53. smilingone Lv 1 21 pts. 10,522
  4. Avatar for Skippysk8s 54. Skippysk8s Lv 1 20 pts. 10,518
  5. Avatar for joremen 55. joremen Lv 1 20 pts. 10,481
  6. Avatar for anthion 56. anthion Lv 1 19 pts. 10,464
  7. Avatar for Crossed Sticks 57. Crossed Sticks Lv 1 18 pts. 10,433
  8. Avatar for 181818 58. 181818 Lv 1 18 pts. 10,430
  9. Avatar for stomjoh 59. stomjoh Lv 1 17 pts. 10,411
  10. Avatar for Hellcat6 60. Hellcat6 Lv 1 16 pts. 10,399

Comments