Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  3. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  4. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  5. Avatar for Deleted group 16. Deleted group pts. 9,609
  6. Avatar for freefolder 17. freefolder 1 pt. 9,580
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  8. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  9. Avatar for BIOF215 20. BIOF215 1 pt. 9,294

  1. Avatar for alcor29 61. alcor29 Lv 1 16 pts. 10,398
  2. Avatar for nicobul 62. nicobul Lv 1 15 pts. 10,387
  3. Avatar for Marvelz 63. Marvelz Lv 1 15 pts. 10,354
  4. Avatar for jobo0502 64. jobo0502 Lv 1 14 pts. 10,294
  5. Avatar for MrZanav 65. MrZanav Lv 1 14 pts. 10,281
  6. Avatar for Glen B 66. Glen B Lv 1 13 pts. 10,271
  7. Avatar for carsonfb 67. carsonfb Lv 1 13 pts. 10,262
  8. Avatar for gdnskye 68. gdnskye Lv 1 12 pts. 10,234
  9. Avatar for Aminal88 69. Aminal88 Lv 1 12 pts. 10,215
  10. Avatar for rabamino12358 70. rabamino12358 Lv 1 11 pts. 10,212

Comments